PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P12470_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family SBP
Protein Properties Length: 350aa    MW: 39282.1 Da    PI: 8.9357
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P12470_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.23.1e-4073150178
                            --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                    SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                            +CqvegC+ dls ak+yhr+h+vCe+hsk+p+v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+++
  GSMUA_Achr4P12470_001  73 CCQVEGCNIDLSGAKDYHRKHRVCETHSKCPKVTVAGQERRFCQQCSRFHDLSEFDQRKRSCRRRLSDHNARRRKPRP 150
                            6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3267135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.29171148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-3873153IPR004333Transcription factor, SBP-box
PfamPF031101.7E-3174147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MKHCFMLFEF SAWAMDWNAN ASLLWDWDNH APFGGNFKLS GGGGASSGSE LGTGSSSKST  60
ISASVDSSAQ SSCCQVEGCN IDLSGAKDYH RKHRVCETHS KCPKVTVAGQ ERRFCQQCSR  120
FHDLSEFDQR KRSCRRRLSD HNARRRKPRP NIISFSSTTF PPLLYDNKHQ MNYLWNNAPF  180
GHMKPMASSK SEGSQTFKLT QIKAPWMKST KEVSIDGQLH LPNTQLSNGF PALYHDVDKL  240
LPLKGTATEV LNQGSEASAG ASNLDRAPDL RRALSLLSTS SWASPDPRQT PPVTEFVDAN  300
SSNHWIYGQP LAQQAQLLPF IMRRYDNQPQ EFQLQKIPYR DAIFDPSQIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-27741471184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129146RKRSCRRRLSDHNARRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396218.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X2
SwissprotA2YGR51e-75SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLM0SNB20.0M0SNB2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P12470_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-44squamosa promoter binding protein-like 2